f cbd ll37 (Biosynth Carbosynth)

Biosynth Carbosynth is a verified supplier

Biosynth Carbosynth manufactures this product

About

News

Press Release

Team

Advisors

Partners

Contact

Bioz Stars

Bioz vStars

Buy from Supplier

Structured Review

Biosynth Carbosynth f cbd ll37
F Cbd Ll37, supplied by Biosynth Carbosynth, used in various techniques. Bioz Stars score: 92/100, based on 10 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
https://www.bioz.com/product/f+cbd+ll37/LL-37/pm31402648-10-34-76
Average 92 stars, based on 10 article reviews

f cbd ll37 - by Bioz Stars, 2026-09

92/100 stars

Images

Modification:

Article Title: Correction to “Concentration-Dependent, Membrane-Selective Activity of Human LL37 Peptides Modified with Collagen Binding Domain Sequences”
Article Snippet: .. From: LL37 peptides modified with collagen binding domains, cCBD-LL37 (LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTESDYKDDDDKTKKTLRT; collagenase-derived cCBD underlined) and f CBD-LL37 ( L L G D F F R K S K E K I G K E F K R I V Q R I K - DFLRNLVPRTESDYKDDDDKCQDSERTFY; fibronectin-derived fCBD underlined), with MW 6317 g/ mol and 6620 g/mol, respectively, were custom synthesized at >90% purity confirmed by HPLC by New England Peptides, Inc. (Gardner, MA). .. To: LL37 peptides modified with collagen binding d om a i n s , cCBD - L L 3 7 ( L LGD F F RK S K - EKIGKEFKRIVQRIKDFLRNLVPRTESDYKDDDDKTKKTLRT; collagenase-derived cCBD underlined) and f CBD-LL37 (LLGDFFRKSKEKIGKEFKRIV Q R I K D F L R N L V P R T E S - DYKDDDDKCQDSETGTFY; fibronectin-derived fCBD underlined), with MW 6317 g/mol and 6620 g/mol, respectively, were custom synthesized at >90% purity confirmed by HPLC by New England Peptides, Inc. (Gardner, MA).

Article Title: Correction to “Concentration-Dependent, Membrane-Selective Activity of Human LL37 Peptides Modified with Collagen Binding Domain Sequences”
Article Snippet: From: LL37 peptides modified with collagen binding domains, cCBD-LL37 (LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTESDYKDDDDKTKKTLRT; collagenase-derived cCBD underlined) and f CBD-LL37 ( L L G D F F R K S K E K I G K E F K R I V Q R I K - DFLRNLVPRTESDYKDDDDKCQDSERTFY; fibronectin-derived fCBD underlined), with MW 6317 g/ mol and 6620 g/mol, respectively, were custom synthesized at >90% purity confirmed by HPLC by New England Peptides, Inc. (Gardner, MA). .. To: LL37 peptides modified with collagen binding d om a i n s , cCBD - L L 3 7 ( L LGD F F RK S K - EKIGKEFKRIVQRIKDFLRNLVPRTESDYKDDDDKTKKTLRT; collagenase-derived cCBD underlined) and f CBD-LL37 (LLGDFFRKSKEKIGKEFKRIV Q R I K D F L R N L V P R T E S - DYKDDDDKCQDSETGTFY; fibronectin-derived fCBD underlined), with MW 6317 g/mol and 6620 g/mol, respectively, were custom synthesized at >90% purity confirmed by HPLC by New England Peptides, Inc. (Gardner, MA). ..

Article Title: Correction to "Concentration-Dependent, Membrane-Selective Activity of Human LL37 Peptides Modified with Collagen Binding Domain Sequences".
Article Snippet: From: LL37 peptides modified with collagen binding domains, cCBD-LL37 (LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTESDYKDDDDKTKKTLRT; collagenase-derived cCBD underlined) and f CBD-LL37 ( L L G D F F R K S K E K I G K E F K R I V Q R I K DFLRNLVPRTESDYKDDDDKCQDSERTFY; fibronectin-derived fCBD underlined), with MW 6317 g/ mol and 6620 g/mol, respectively, were custom synthesized at >90% purity confirmed by HPLC by New England Peptides, Inc. (Gardner, MA). .. To: LL37 peptides modified with collagen binding d om a i n s , cCBD L L 3 7 ( L LGD F F RK S K EKIGKEFKRIVQRIKDFLRNLVPRTESDYKDDDDKTKKTLRT; collagenase-derived cCBD underlined) and f CBD-LL37 (LLGDFFRKSKEKIGKEFKRIV Q R I K D F L R N L V P R T E S DYKDDDDKCQDSETGTFY; fibronectin-derived fCBD underlined), with MW 6317 g/mol and 6620 g/mol, respectively, were custom synthesized at >90% purity confirmed by HPLC by New England Peptides, Inc. (Gardner, MA). ..

Binding Assay:

Article Title: Correction to “Concentration-Dependent, Membrane-Selective Activity of Human LL37 Peptides Modified with Collagen Binding Domain Sequences”
Article Snippet: From: LL37 peptides modified with collagen binding domains, cCBD-LL37 (LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTESDYKDDDDKTKKTLRT; collagenase-derived cCBD underlined) and f CBD-LL37 ( L L G D F F R K S K E K I G K E F K R I V Q R I K - DFLRNLVPRTESDYKDDDDKCQDSERTFY; fibronectin-derived fCBD underlined), with MW 6317 g/ mol and 6620 g/mol, respectively, were custom synthesized at >90% purity confirmed by HPLC by New England Peptides, Inc. (Gardner, MA). .. To: LL37 peptides modified with collagen binding d om a i n s , cCBD - L L 3 7 ( L LGD F F RK S K - EKIGKEFKRIVQRIKDFLRNLVPRTESDYKDDDDKTKKTLRT; collagenase-derived cCBD underlined) and f CBD-LL37 (LLGDFFRKSKEKIGKEFKRIV Q R I K D F L R N L V P R T E S - DYKDDDDKCQDSETGTFY; fibronectin-derived fCBD underlined), with MW 6317 g/mol and 6620 g/mol, respectively, were custom synthesized at >90% purity confirmed by HPLC by New England Peptides, Inc. (Gardner, MA). ..

Synthesized:

Article Title: Correction to “Concentration-Dependent, Membrane-Selective Activity of Human LL37 Peptides Modified with Collagen Binding Domain Sequences”
Article Snippet: From: LL37 peptides modified with collagen binding domains, cCBD-LL37 (LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTESDYKDDDDKTKKTLRT; collagenase-derived cCBD underlined) and f CBD-LL37 ( L L G D F F R K S K E K I G K E F K R I V Q R I K - DFLRNLVPRTESDYKDDDDKCQDSERTFY; fibronectin-derived fCBD underlined), with MW 6317 g/ mol and 6620 g/mol, respectively, were custom synthesized at >90% purity confirmed by HPLC by New England Peptides, Inc. (Gardner, MA). .. To: LL37 peptides modified with collagen binding d om a i n s , cCBD - L L 3 7 ( L LGD F F RK S K - EKIGKEFKRIVQRIKDFLRNLVPRTESDYKDDDDKTKKTLRT; collagenase-derived cCBD underlined) and f CBD-LL37 (LLGDFFRKSKEKIGKEFKRIV Q R I K D F L R N L V P R T E S - DYKDDDDKCQDSETGTFY; fibronectin-derived fCBD underlined), with MW 6317 g/mol and 6620 g/mol, respectively, were custom synthesized at >90% purity confirmed by HPLC by New England Peptides, Inc. (Gardner, MA). ..

High Performance Liquid Chromatography:

Article Title: Correction to “Concentration-Dependent, Membrane-Selective Activity of Human LL37 Peptides Modified with Collagen Binding Domain Sequences”
Article Snippet: From: LL37 peptides modified with collagen binding domains, cCBD-LL37 (LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTESDYKDDDDKTKKTLRT; collagenase-derived cCBD underlined) and f CBD-LL37 ( L L G D F F R K S K E K I G K E F K R I V Q R I K - DFLRNLVPRTESDYKDDDDKCQDSERTFY; fibronectin-derived fCBD underlined), with MW 6317 g/ mol and 6620 g/mol, respectively, were custom synthesized at >90% purity confirmed by HPLC by New England Peptides, Inc. (Gardner, MA). .. To: LL37 peptides modified with collagen binding d om a i n s , cCBD - L L 3 7 ( L LGD F F RK S K - EKIGKEFKRIVQRIKDFLRNLVPRTESDYKDDDDKTKKTLRT; collagenase-derived cCBD underlined) and f CBD-LL37 (LLGDFFRKSKEKIGKEFKRIV Q R I K D F L R N L V P R T E S - DYKDDDDKCQDSETGTFY; fibronectin-derived fCBD underlined), with MW 6317 g/mol and 6620 g/mol, respectively, were custom synthesized at >90% purity confirmed by HPLC by New England Peptides, Inc. (Gardner, MA). ..

Review